Anti RAI2 pAb (ATL-HPA051054)

Atlas Antibodies

Catalog No.:
ATL-HPA051054-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: retinoic acid induced 2
Gene Name: RAI2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043518: 97%, ENSRNOG00000006670: 94%
Entrez Gene ID: 10742
Uniprot ID: Q9Y5P3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKVIVSVEDAVPTIFCGKIKGLSGVSTKNFSFKREDSVLQGYDINSQGEESMGNAEPLRKPIKNRSIKLKKVNSQEIH
Gene Sequence AKVIVSVEDAVPTIFCGKIKGLSGVSTKNFSFKREDSVLQGYDINSQGEESMGNAEPLRKPIKNRSIKLKKVNSQEIH
Gene ID - Mouse ENSMUSG00000043518
Gene ID - Rat ENSRNOG00000006670
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAI2 pAb (ATL-HPA051054)
Datasheet Anti RAI2 pAb (ATL-HPA051054) Datasheet (External Link)
Vendor Page Anti RAI2 pAb (ATL-HPA051054) at Atlas Antibodies

Documents & Links for Anti RAI2 pAb (ATL-HPA051054)
Datasheet Anti RAI2 pAb (ATL-HPA051054) Datasheet (External Link)
Vendor Page Anti RAI2 pAb (ATL-HPA051054)