Anti RAG2 pAb (ATL-HPA065704)

Atlas Antibodies

Catalog No.:
ATL-HPA065704-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: recombination activating 2
Gene Name: RAG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032864: 90%, ENSRNOG00000004623: 91%
Entrez Gene ID: 5897
Uniprot ID: P55895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HGGKTPNNEVSDKIYVMSIVCKNNKKVTFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGVLFGGRSYMPSTHRTTEKWNSVADCLPCVFLVDF
Gene Sequence HGGKTPNNEVSDKIYVMSIVCKNNKKVTFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGVLFGGRSYMPSTHRTTEKWNSVADCLPCVFLVDF
Gene ID - Mouse ENSMUSG00000032864
Gene ID - Rat ENSRNOG00000004623
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAG2 pAb (ATL-HPA065704)
Datasheet Anti RAG2 pAb (ATL-HPA065704) Datasheet (External Link)
Vendor Page Anti RAG2 pAb (ATL-HPA065704) at Atlas Antibodies

Documents & Links for Anti RAG2 pAb (ATL-HPA065704)
Datasheet Anti RAG2 pAb (ATL-HPA065704) Datasheet (External Link)
Vendor Page Anti RAG2 pAb (ATL-HPA065704)