Anti RADIL pAb (ATL-HPA051776)

Atlas Antibodies

Catalog No.:
ATL-HPA051776-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Ras association and DIL domains
Gene Name: RADIL
Alternative Gene Name: FLJ10324, KIAA1849, RASIP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029576: 93%, ENSRNOG00000024456: 95%
Entrez Gene ID: 55698
Uniprot ID: Q96JH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YGTHFIMSPPTKSKLKRQSQLLSSMLSRTLSYKYRDLDSTFSSLGASDDPAELSTQLSAPGVLKVFGDSVCTGTHYKSVLA
Gene Sequence YGTHFIMSPPTKSKLKRQSQLLSSMLSRTLSYKYRDLDSTFSSLGASDDPAELSTQLSAPGVLKVFGDSVCTGTHYKSVLA
Gene ID - Mouse ENSMUSG00000029576
Gene ID - Rat ENSRNOG00000024456
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RADIL pAb (ATL-HPA051776)
Datasheet Anti RADIL pAb (ATL-HPA051776) Datasheet (External Link)
Vendor Page Anti RADIL pAb (ATL-HPA051776) at Atlas Antibodies

Documents & Links for Anti RADIL pAb (ATL-HPA051776)
Datasheet Anti RADIL pAb (ATL-HPA051776) Datasheet (External Link)
Vendor Page Anti RADIL pAb (ATL-HPA051776)