Anti RAD54L2 pAb (ATL-HPA077351)

Atlas Antibodies

SKU:
ATL-HPA077351-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts and Leydig cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RAD54 like 2
Gene Name: RAD54L2
Alternative Gene Name: ARIP4, KIAA0809, SRISNF2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040661: 94%, ENSRNOG00000013570: 94%
Entrez Gene ID: 23132
Uniprot ID: Q9Y4B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KAFCVCCKIWNHPDVLYEALQKESLANEQDLDVEELGSAGTSARCPPQGTKGKGEDSTLASSMGEATNSKFLQGVGFNPFQERGNNIVTYEWAKDLLTNYQTG
Gene Sequence KAFCVCCKIWNHPDVLYEALQKESLANEQDLDVEELGSAGTSARCPPQGTKGKGEDSTLASSMGEATNSKFLQGVGFNPFQERGNNIVTYEWAKDLLTNYQTG
Gene ID - Mouse ENSMUSG00000040661
Gene ID - Rat ENSRNOG00000013570
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RAD54L2 pAb (ATL-HPA077351)
Datasheet Anti RAD54L2 pAb (ATL-HPA077351) Datasheet (External Link)
Vendor Page Anti RAD54L2 pAb (ATL-HPA077351) at Atlas Antibodies

Documents & Links for Anti RAD54L2 pAb (ATL-HPA077351)
Datasheet Anti RAD54L2 pAb (ATL-HPA077351) Datasheet (External Link)
Vendor Page Anti RAD54L2 pAb (ATL-HPA077351)