Anti RAD54L pAb (ATL-HPA051537)

Atlas Antibodies

Catalog No.:
ATL-HPA051537-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RAD54-like (S. cerevisiae)
Gene Name: RAD54L
Alternative Gene Name: hHR54, hRAD54, RAD54A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028702: 92%, ENSRNOG00000013148: 88%
Entrez Gene ID: 8438
Uniprot ID: Q92698
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKRKPEGRSCDDEDWQPGLVTPRKRKSSSETQIQECFLSPFRKPLSQLTNQPPCLDSSQHEAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEKDALVLYEPPPLSAHDQLKLDKEKLPVHVVVDPILSKVL
Gene Sequence AKRKPEGRSCDDEDWQPGLVTPRKRKSSSETQIQECFLSPFRKPLSQLTNQPPCLDSSQHEAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEKDALVLYEPPPLSAHDQLKLDKEKLPVHVVVDPILSKVL
Gene ID - Mouse ENSMUSG00000028702
Gene ID - Rat ENSRNOG00000013148
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAD54L pAb (ATL-HPA051537)
Datasheet Anti RAD54L pAb (ATL-HPA051537) Datasheet (External Link)
Vendor Page Anti RAD54L pAb (ATL-HPA051537) at Atlas Antibodies

Documents & Links for Anti RAD54L pAb (ATL-HPA051537)
Datasheet Anti RAD54L pAb (ATL-HPA051537) Datasheet (External Link)
Vendor Page Anti RAD54L pAb (ATL-HPA051537)