Anti RAD54B pAb (ATL-HPA007087)

Atlas Antibodies

Catalog No.:
ATL-HPA007087-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RAD54 homolog B (S. cerevisiae)
Gene Name: RAD54B
Alternative Gene Name: RDH54
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078773: 76%, ENSRNOG00000039949: 76%
Entrez Gene ID: 25788
Uniprot ID: Q9Y620
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEQEEKSDSLVKYFSVVWCKPSKKKHKKWEGDAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEVMGVISPDDFSSGRCFQLGGGSTAISHSSQVARKCFSNP
Gene Sequence KEQEEKSDSLVKYFSVVWCKPSKKKHKKWEGDAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEVMGVISPDDFSSGRCFQLGGGSTAISHSSQVARKCFSNP
Gene ID - Mouse ENSMUSG00000078773
Gene ID - Rat ENSRNOG00000039949
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAD54B pAb (ATL-HPA007087)
Datasheet Anti RAD54B pAb (ATL-HPA007087) Datasheet (External Link)
Vendor Page Anti RAD54B pAb (ATL-HPA007087) at Atlas Antibodies

Documents & Links for Anti RAD54B pAb (ATL-HPA007087)
Datasheet Anti RAD54B pAb (ATL-HPA007087) Datasheet (External Link)
Vendor Page Anti RAD54B pAb (ATL-HPA007087)
Citations for Anti RAD54B pAb (ATL-HPA007087) – 2 Found
Feng, Senwen; Liu, Junhao; Hailiang, Li; Wen, Jianfan; Zhao, Yujun; Li, Xiaofeng; Lu, Guankun; Gao, Peng; Zeng, Xiancheng. Amplification of RAD54B promotes progression of hepatocellular carcinoma via activating the Wnt/β-catenin signaling. Translational Oncology. 2021;14(8):101124.  PubMed
Xu, Chuan; Liu, Di; Mei, Hong; Hu, Jian; Luo, Meng. Knockdown of RAD54B expression reduces cell proliferation and induces apoptosis in lung cancer cells. The Journal Of International Medical Research. 2019;47(11):5650-5659.  PubMed