Anti RAD54B pAb (ATL-HPA007087)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007087-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RAD54B
Alternative Gene Name: RDH54
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078773: 76%, ENSRNOG00000039949: 76%
Entrez Gene ID: 25788
Uniprot ID: Q9Y620
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KEQEEKSDSLVKYFSVVWCKPSKKKHKKWEGDAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEVMGVISPDDFSSGRCFQLGGGSTAISHSSQVARKCFSNP |
| Gene Sequence | KEQEEKSDSLVKYFSVVWCKPSKKKHKKWEGDAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEVMGVISPDDFSSGRCFQLGGGSTAISHSSQVARKCFSNP |
| Gene ID - Mouse | ENSMUSG00000078773 |
| Gene ID - Rat | ENSRNOG00000039949 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RAD54B pAb (ATL-HPA007087) | |
| Datasheet | Anti RAD54B pAb (ATL-HPA007087) Datasheet (External Link) |
| Vendor Page | Anti RAD54B pAb (ATL-HPA007087) at Atlas Antibodies |
| Documents & Links for Anti RAD54B pAb (ATL-HPA007087) | |
| Datasheet | Anti RAD54B pAb (ATL-HPA007087) Datasheet (External Link) |
| Vendor Page | Anti RAD54B pAb (ATL-HPA007087) |
| Citations for Anti RAD54B pAb (ATL-HPA007087) – 2 Found |
| Feng, Senwen; Liu, Junhao; Hailiang, Li; Wen, Jianfan; Zhao, Yujun; Li, Xiaofeng; Lu, Guankun; Gao, Peng; Zeng, Xiancheng. Amplification of RAD54B promotes progression of hepatocellular carcinoma via activating the Wnt/β-catenin signaling. Translational Oncology. 2021;14(8):101124. PubMed |
| Xu, Chuan; Liu, Di; Mei, Hong; Hu, Jian; Luo, Meng. Knockdown of RAD54B expression reduces cell proliferation and induces apoptosis in lung cancer cells. The Journal Of International Medical Research. 2019;47(11):5650-5659. PubMed |