Anti RAD51AP1 pAb (ATL-HPA051499)

Atlas Antibodies

Catalog No.:
ATL-HPA051499-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: RAD51 associated protein 1
Gene Name: RAD51AP1
Alternative Gene Name: PIR51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030346: 60%, ENSRNOG00000059878: 55%
Entrez Gene ID: 10635
Uniprot ID: Q96B01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLEVALALSVKELPTVTTNVQNSQDKSIEKHGSSKIETMNKSPHISNCSVASDYLDLDKITVEDDVGGVQGKRKAASK
Gene Sequence DLEVALALSVKELPTVTTNVQNSQDKSIEKHGSSKIETMNKSPHISNCSVASDYLDLDKITVEDDVGGVQGKRKAASK
Gene ID - Mouse ENSMUSG00000030346
Gene ID - Rat ENSRNOG00000059878
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAD51AP1 pAb (ATL-HPA051499)
Datasheet Anti RAD51AP1 pAb (ATL-HPA051499) Datasheet (External Link)
Vendor Page Anti RAD51AP1 pAb (ATL-HPA051499) at Atlas Antibodies

Documents & Links for Anti RAD51AP1 pAb (ATL-HPA051499)
Datasheet Anti RAD51AP1 pAb (ATL-HPA051499) Datasheet (External Link)
Vendor Page Anti RAD51AP1 pAb (ATL-HPA051499)