Anti RAD50 pAb (ATL-HPA052291)

Atlas Antibodies

Catalog No.:
ATL-HPA052291-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: RAD50 homolog (S. cerevisiae)
Gene Name: RAD50
Alternative Gene Name: hRad50, RAD50-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020380: 100%, ENSRNOG00000033065: 99%
Entrez Gene ID: 10111
Uniprot ID: Q92878
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELREPQFRDAEEKYREMMIVMRTTELVNKDLDIYYKTLDQAIMKFHSMKMEEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVV
Gene Sequence ELREPQFRDAEEKYREMMIVMRTTELVNKDLDIYYKTLDQAIMKFHSMKMEEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVV
Gene ID - Mouse ENSMUSG00000020380
Gene ID - Rat ENSRNOG00000033065
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAD50 pAb (ATL-HPA052291)
Datasheet Anti RAD50 pAb (ATL-HPA052291) Datasheet (External Link)
Vendor Page Anti RAD50 pAb (ATL-HPA052291) at Atlas Antibodies

Documents & Links for Anti RAD50 pAb (ATL-HPA052291)
Datasheet Anti RAD50 pAb (ATL-HPA052291) Datasheet (External Link)
Vendor Page Anti RAD50 pAb (ATL-HPA052291)