Anti RAD50 pAb (ATL-HPA052291)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052291-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: RAD50
Alternative Gene Name: hRad50, RAD50-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020380: 100%, ENSRNOG00000033065: 99%
Entrez Gene ID: 10111
Uniprot ID: Q92878
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELREPQFRDAEEKYREMMIVMRTTELVNKDLDIYYKTLDQAIMKFHSMKMEEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVV |
| Gene Sequence | ELREPQFRDAEEKYREMMIVMRTTELVNKDLDIYYKTLDQAIMKFHSMKMEEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVV |
| Gene ID - Mouse | ENSMUSG00000020380 |
| Gene ID - Rat | ENSRNOG00000033065 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RAD50 pAb (ATL-HPA052291) | |
| Datasheet | Anti RAD50 pAb (ATL-HPA052291) Datasheet (External Link) |
| Vendor Page | Anti RAD50 pAb (ATL-HPA052291) at Atlas Antibodies |
| Documents & Links for Anti RAD50 pAb (ATL-HPA052291) | |
| Datasheet | Anti RAD50 pAb (ATL-HPA052291) Datasheet (External Link) |
| Vendor Page | Anti RAD50 pAb (ATL-HPA052291) |