Anti RAD23A pAb (ATL-HPA057003)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057003-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: RAD23A
Alternative Gene Name: HHR23A, MGC111083
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003813: 95%, ENSRNOG00000003026: 93%
Entrez Gene ID: 5886
Uniprot ID: P54725
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQ |
Gene Sequence | YLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQ |
Gene ID - Mouse | ENSMUSG00000003813 |
Gene ID - Rat | ENSRNOG00000003026 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RAD23A pAb (ATL-HPA057003) | |
Datasheet | Anti RAD23A pAb (ATL-HPA057003) Datasheet (External Link) |
Vendor Page | Anti RAD23A pAb (ATL-HPA057003) at Atlas Antibodies |
Documents & Links for Anti RAD23A pAb (ATL-HPA057003) | |
Datasheet | Anti RAD23A pAb (ATL-HPA057003) Datasheet (External Link) |
Vendor Page | Anti RAD23A pAb (ATL-HPA057003) |