Anti RAD23A pAb (ATL-HPA057003)

Atlas Antibodies

Catalog No.:
ATL-HPA057003-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: RAD23 homolog A, nucleotide excision repair protein
Gene Name: RAD23A
Alternative Gene Name: HHR23A, MGC111083
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003813: 95%, ENSRNOG00000003026: 93%
Entrez Gene ID: 5886
Uniprot ID: P54725
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQ
Gene Sequence YLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQ
Gene ID - Mouse ENSMUSG00000003813
Gene ID - Rat ENSRNOG00000003026
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAD23A pAb (ATL-HPA057003)
Datasheet Anti RAD23A pAb (ATL-HPA057003) Datasheet (External Link)
Vendor Page Anti RAD23A pAb (ATL-HPA057003) at Atlas Antibodies

Documents & Links for Anti RAD23A pAb (ATL-HPA057003)
Datasheet Anti RAD23A pAb (ATL-HPA057003) Datasheet (External Link)
Vendor Page Anti RAD23A pAb (ATL-HPA057003)