Anti RAD21L1 pAb (ATL-HPA053282)

Atlas Antibodies

Catalog No.:
ATL-HPA053282-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RAD21-like 1 (S. pombe)
Gene Name: RAD21L1
Alternative Gene Name: dJ545L17.2, RAD21L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074704: 68%, ENSRNOG00000022335: 60%
Entrez Gene ID: 642636
Uniprot ID: Q9H4I0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRGGVHTLLSTAAQDLIHAELKMLFTKCFLSSGFKLGRKMIQKESVREEVGNQNIVETSMMQEPNYQQELSKPQTWKDVIG
Gene Sequence KRGGVHTLLSTAAQDLIHAELKMLFTKCFLSSGFKLGRKMIQKESVREEVGNQNIVETSMMQEPNYQQELSKPQTWKDVIG
Gene ID - Mouse ENSMUSG00000074704
Gene ID - Rat ENSRNOG00000022335
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAD21L1 pAb (ATL-HPA053282)
Datasheet Anti RAD21L1 pAb (ATL-HPA053282) Datasheet (External Link)
Vendor Page Anti RAD21L1 pAb (ATL-HPA053282) at Atlas Antibodies

Documents & Links for Anti RAD21L1 pAb (ATL-HPA053282)
Datasheet Anti RAD21L1 pAb (ATL-HPA053282) Datasheet (External Link)
Vendor Page Anti RAD21L1 pAb (ATL-HPA053282)