Anti RABGAP1L pAb (ATL-HPA054695)

Atlas Antibodies

Catalog No.: ATL-HPA054695-25

Protein Description: RAB GTPase activating protein 1-like
Gene Name: RABGAP1L
Alternative Gene Name: FLJ38519, HHL, KIAA0471, TBC1D18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026721: 78%, ENSRNOG00000002736: 80%
Entrez Gene ID: 9910
Uniprot ID: Q5R372
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVRASLQKVSGSSDSVATMNSEEFVLVPQYADDNSTKHEEKPQLKIVSNGDEQLE
• Gene Sequence: EVRASLQKVSGSSDSVATMNSEEFVLVPQYADDNSTKHEEKPQLKIVSNGDEQLE
• Gene ID - Mouse: ENSMUSG00000026721
• Gene ID - Rat: ENSRNOG00000002736
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.