Anti RABGAP1L pAb (ATL-HPA054695)

Atlas Antibodies

Catalog No.:
ATL-HPA054695-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RAB GTPase activating protein 1-like
Gene Name: RABGAP1L
Alternative Gene Name: FLJ38519, HHL, KIAA0471, TBC1D18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026721: 78%, ENSRNOG00000002736: 80%
Entrez Gene ID: 9910
Uniprot ID: Q5R372
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVRASLQKVSGSSDSVATMNSEEFVLVPQYADDNSTKHEEKPQLKIVSNGDEQLE
Gene Sequence EVRASLQKVSGSSDSVATMNSEEFVLVPQYADDNSTKHEEKPQLKIVSNGDEQLE
Gene ID - Mouse ENSMUSG00000026721
Gene ID - Rat ENSRNOG00000002736
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RABGAP1L pAb (ATL-HPA054695)
Datasheet Anti RABGAP1L pAb (ATL-HPA054695) Datasheet (External Link)
Vendor Page Anti RABGAP1L pAb (ATL-HPA054695) at Atlas Antibodies

Documents & Links for Anti RABGAP1L pAb (ATL-HPA054695)
Datasheet Anti RABGAP1L pAb (ATL-HPA054695) Datasheet (External Link)
Vendor Page Anti RABGAP1L pAb (ATL-HPA054695)