Anti RABGAP1 pAb (ATL-HPA064860)
Atlas Antibodies
- SKU:
- ATL-HPA064860-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RABGAP1
Alternative Gene Name: GAPCenA, TBC1D11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035437: 97%, ENSRNOG00000009402: 97%
Entrez Gene ID: 23637
Uniprot ID: Q9Y3P9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PLSNQLSASSTINPVPLVGLQKPEMSLPVKPGQGDSEASSPFTPVADEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRSQCQIS |
Gene Sequence | PLSNQLSASSTINPVPLVGLQKPEMSLPVKPGQGDSEASSPFTPVADEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRSQCQIS |
Gene ID - Mouse | ENSMUSG00000035437 |
Gene ID - Rat | ENSRNOG00000009402 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RABGAP1 pAb (ATL-HPA064860) | |
Datasheet | Anti RABGAP1 pAb (ATL-HPA064860) Datasheet (External Link) |
Vendor Page | Anti RABGAP1 pAb (ATL-HPA064860) at Atlas Antibodies |
Documents & Links for Anti RABGAP1 pAb (ATL-HPA064860) | |
Datasheet | Anti RABGAP1 pAb (ATL-HPA064860) Datasheet (External Link) |
Vendor Page | Anti RABGAP1 pAb (ATL-HPA064860) |