Anti RABGAP1 pAb (ATL-HPA064860)

Atlas Antibodies

Catalog No.:
ATL-HPA064860-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RAB GTPase activating protein 1
Gene Name: RABGAP1
Alternative Gene Name: GAPCenA, TBC1D11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035437: 97%, ENSRNOG00000009402: 97%
Entrez Gene ID: 23637
Uniprot ID: Q9Y3P9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLSNQLSASSTINPVPLVGLQKPEMSLPVKPGQGDSEASSPFTPVADEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRSQCQIS
Gene Sequence PLSNQLSASSTINPVPLVGLQKPEMSLPVKPGQGDSEASSPFTPVADEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRSQCQIS
Gene ID - Mouse ENSMUSG00000035437
Gene ID - Rat ENSRNOG00000009402
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RABGAP1 pAb (ATL-HPA064860)
Datasheet Anti RABGAP1 pAb (ATL-HPA064860) Datasheet (External Link)
Vendor Page Anti RABGAP1 pAb (ATL-HPA064860) at Atlas Antibodies

Documents & Links for Anti RABGAP1 pAb (ATL-HPA064860)
Datasheet Anti RABGAP1 pAb (ATL-HPA064860) Datasheet (External Link)
Vendor Page Anti RABGAP1 pAb (ATL-HPA064860)