Anti RABEP2 pAb (ATL-HPA047641)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047641-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RABEP2
Alternative Gene Name: FLJ23282, FRA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030727: 82%, ENSRNOG00000018462: 82%
Entrez Gene ID: 79874
Uniprot ID: Q9H5N1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LKAKLLRAEELIQEIQRRPRHAPSLHGSTELLPLSRDPSPPLEPLEELSGDGGPAAEAFAHNCDDSASISSFSLGGGVGSSSSLPQSRQGLSPE |
Gene Sequence | LKAKLLRAEELIQEIQRRPRHAPSLHGSTELLPLSRDPSPPLEPLEELSGDGGPAAEAFAHNCDDSASISSFSLGGGVGSSSSLPQSRQGLSPE |
Gene ID - Mouse | ENSMUSG00000030727 |
Gene ID - Rat | ENSRNOG00000018462 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RABEP2 pAb (ATL-HPA047641) | |
Datasheet | Anti RABEP2 pAb (ATL-HPA047641) Datasheet (External Link) |
Vendor Page | Anti RABEP2 pAb (ATL-HPA047641) at Atlas Antibodies |
Documents & Links for Anti RABEP2 pAb (ATL-HPA047641) | |
Datasheet | Anti RABEP2 pAb (ATL-HPA047641) Datasheet (External Link) |
Vendor Page | Anti RABEP2 pAb (ATL-HPA047641) |