Anti RABAC1 pAb (ATL-HPA029171 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029171-100

Protein Description: Rab acceptor 1 (prenylated)
Gene Name: RABAC1
Alternative Gene Name: PRA1, PRAF1, YIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003380: 95%, ENSRNOG00000020233: 95%
Entrez Gene ID: 10567
Uniprot ID: Q9UI14
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRP
• Gene Sequence: MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRP
• Gene ID - Mouse: ENSMUSG00000003380
• Gene ID - Rat: ENSRNOG00000020233
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.