Anti RAB8B pAb (ATL-HPA074534)

Atlas Antibodies

Catalog No.:
ATL-HPA074534-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: RAB8B, member RAS oncogene family
Gene Name: RAB8B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036943: 94%, ENSRNOG00000018009: 94%
Entrez Gene ID: 51762
Uniprot ID: Q92930
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL
Gene Sequence SSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL
Gene ID - Mouse ENSMUSG00000036943
Gene ID - Rat ENSRNOG00000018009
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAB8B pAb (ATL-HPA074534)
Datasheet Anti RAB8B pAb (ATL-HPA074534) Datasheet (External Link)
Vendor Page Anti RAB8B pAb (ATL-HPA074534) at Atlas Antibodies

Documents & Links for Anti RAB8B pAb (ATL-HPA074534)
Datasheet Anti RAB8B pAb (ATL-HPA074534) Datasheet (External Link)
Vendor Page Anti RAB8B pAb (ATL-HPA074534)