Anti RAB3IL1 pAb (ATL-HPA039723)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039723-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RAB3IL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038384: 32%, ENSRNOG00000029614: 32%
Entrez Gene ID: 5866
Uniprot ID: Q8TBN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MDSSEEHAGCPARGTCPVFLAMSAGTVRYAPSGLCPVLEGNLREEPWGTDSPPQPDQGLPPPLAAVPV |
Gene Sequence | MDSSEEHAGCPARGTCPVFLAMSAGTVRYAPSGLCPVLEGNLREEPWGTDSPPQPDQGLPPPLAAVPV |
Gene ID - Mouse | ENSMUSG00000038384 |
Gene ID - Rat | ENSRNOG00000029614 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RAB3IL1 pAb (ATL-HPA039723) | |
Datasheet | Anti RAB3IL1 pAb (ATL-HPA039723) Datasheet (External Link) |
Vendor Page | Anti RAB3IL1 pAb (ATL-HPA039723) at Atlas Antibodies |
Documents & Links for Anti RAB3IL1 pAb (ATL-HPA039723) | |
Datasheet | Anti RAB3IL1 pAb (ATL-HPA039723) Datasheet (External Link) |
Vendor Page | Anti RAB3IL1 pAb (ATL-HPA039723) |