Anti RAB3IL1 pAb (ATL-HPA039723)

Atlas Antibodies

Catalog No.:
ATL-HPA039723-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RAB3A interacting protein (rabin3)-like 1
Gene Name: RAB3IL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038384: 32%, ENSRNOG00000029614: 32%
Entrez Gene ID: 5866
Uniprot ID: Q8TBN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDSSEEHAGCPARGTCPVFLAMSAGTVRYAPSGLCPVLEGNLREEPWGTDSPPQPDQGLPPPLAAVPV
Gene Sequence MDSSEEHAGCPARGTCPVFLAMSAGTVRYAPSGLCPVLEGNLREEPWGTDSPPQPDQGLPPPLAAVPV
Gene ID - Mouse ENSMUSG00000038384
Gene ID - Rat ENSRNOG00000029614
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAB3IL1 pAb (ATL-HPA039723)
Datasheet Anti RAB3IL1 pAb (ATL-HPA039723) Datasheet (External Link)
Vendor Page Anti RAB3IL1 pAb (ATL-HPA039723) at Atlas Antibodies

Documents & Links for Anti RAB3IL1 pAb (ATL-HPA039723)
Datasheet Anti RAB3IL1 pAb (ATL-HPA039723) Datasheet (External Link)
Vendor Page Anti RAB3IL1 pAb (ATL-HPA039723)