Anti RAB3GAP2 pAb (ATL-HPA027299)

Atlas Antibodies

Catalog No.: ATL-HPA027299-25

Protein Description: RAB3 GTPase activating protein subunit 2 (non-catalytic)
Gene Name: RAB3GAP2
Alternative Gene Name: DKFZP434D245, KIAA0839, RAB3-GAP150, SPG69
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039318: 90%, ENSRNOG00000002353: 89%
Entrez Gene ID: 25782
Uniprot ID: Q9H2M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EHHSILCSILYAVMRFSLKTVKPLSLFDSKGKNAFFKDLTSIQLLPSGEMDPNFISVRQQFLLKVVSAAVQAQHSATKVKDPT
• Gene Sequence: EHHSILCSILYAVMRFSLKTVKPLSLFDSKGKNAFFKDLTSIQLLPSGEMDPNFISVRQQFLLKVVSAAVQAQHSATKVKDPT
• Gene ID - Mouse: ENSMUSG00000039318
• Gene ID - Rat: ENSRNOG00000002353
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.