Anti RAB3GAP2 pAb (ATL-HPA027299)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027299-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RAB3GAP2
Alternative Gene Name: DKFZP434D245, KIAA0839, RAB3-GAP150, SPG69
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039318: 90%, ENSRNOG00000002353: 89%
Entrez Gene ID: 25782
Uniprot ID: Q9H2M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EHHSILCSILYAVMRFSLKTVKPLSLFDSKGKNAFFKDLTSIQLLPSGEMDPNFISVRQQFLLKVVSAAVQAQHSATKVKDPT |
Gene Sequence | EHHSILCSILYAVMRFSLKTVKPLSLFDSKGKNAFFKDLTSIQLLPSGEMDPNFISVRQQFLLKVVSAAVQAQHSATKVKDPT |
Gene ID - Mouse | ENSMUSG00000039318 |
Gene ID - Rat | ENSRNOG00000002353 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RAB3GAP2 pAb (ATL-HPA027299) | |
Datasheet | Anti RAB3GAP2 pAb (ATL-HPA027299) Datasheet (External Link) |
Vendor Page | Anti RAB3GAP2 pAb (ATL-HPA027299) at Atlas Antibodies |
Documents & Links for Anti RAB3GAP2 pAb (ATL-HPA027299) | |
Datasheet | Anti RAB3GAP2 pAb (ATL-HPA027299) Datasheet (External Link) |
Vendor Page | Anti RAB3GAP2 pAb (ATL-HPA027299) |