Anti RAB35 pAb (ATL-HPA054146)

Atlas Antibodies

Catalog No.:
ATL-HPA054146-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RAB35, member RAS oncogene family
Gene Name: RAB35
Alternative Gene Name: H-ray
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029518: 100%, ENSRNOG00000022014: 100%
Entrez Gene ID: 11021
Uniprot ID: Q15286
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRC
Gene Sequence AKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRC
Gene ID - Mouse ENSMUSG00000029518
Gene ID - Rat ENSRNOG00000022014
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAB35 pAb (ATL-HPA054146)
Datasheet Anti RAB35 pAb (ATL-HPA054146) Datasheet (External Link)
Vendor Page Anti RAB35 pAb (ATL-HPA054146) at Atlas Antibodies

Documents & Links for Anti RAB35 pAb (ATL-HPA054146)
Datasheet Anti RAB35 pAb (ATL-HPA054146) Datasheet (External Link)
Vendor Page Anti RAB35 pAb (ATL-HPA054146)