Anti RAB30 pAb (ATL-HPA054514)

Atlas Antibodies

Catalog No.:
ATL-HPA054514-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RAB30, member RAS oncogene family
Gene Name: RAB30
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030643: 100%, ENSRNOG00000010224: 100%
Entrez Gene ID: 27314
Uniprot ID: Q15771
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVG
Gene Sequence RSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVG
Gene ID - Mouse ENSMUSG00000030643
Gene ID - Rat ENSRNOG00000010224
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAB30 pAb (ATL-HPA054514)
Datasheet Anti RAB30 pAb (ATL-HPA054514) Datasheet (External Link)
Vendor Page Anti RAB30 pAb (ATL-HPA054514) at Atlas Antibodies

Documents & Links for Anti RAB30 pAb (ATL-HPA054514)
Datasheet Anti RAB30 pAb (ATL-HPA054514) Datasheet (External Link)
Vendor Page Anti RAB30 pAb (ATL-HPA054514)