Anti RAB29 pAb (ATL-HPA026303)

Atlas Antibodies

Catalog No.: ATL-HPA026303-25

Protein Description: RAB29, member RAS oncogene family
Gene Name: RAB29
Alternative Gene Name: RAB7L, RAB7L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026433: 89%, ENSRNOG00000049641: 91%
Entrez Gene ID: 8934
Uniprot ID: O14966
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKS
• Gene Sequence: LDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKS
• Gene ID - Mouse: ENSMUSG00000026433
• Gene ID - Rat: ENSRNOG00000049641
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.