Anti RAB29 pAb (ATL-HPA026303)

Atlas Antibodies

Catalog No.:
ATL-HPA026303-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RAB29, member RAS oncogene family
Gene Name: RAB29
Alternative Gene Name: RAB7L, RAB7L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026433: 89%, ENSRNOG00000049641: 91%
Entrez Gene ID: 8934
Uniprot ID: O14966
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKS
Gene Sequence LDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKS
Gene ID - Mouse ENSMUSG00000026433
Gene ID - Rat ENSRNOG00000049641
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAB29 pAb (ATL-HPA026303)
Datasheet Anti RAB29 pAb (ATL-HPA026303) Datasheet (External Link)
Vendor Page Anti RAB29 pAb (ATL-HPA026303) at Atlas Antibodies

Documents & Links for Anti RAB29 pAb (ATL-HPA026303)
Datasheet Anti RAB29 pAb (ATL-HPA026303) Datasheet (External Link)
Vendor Page Anti RAB29 pAb (ATL-HPA026303)