Anti RAB20 pAb (ATL-HPA068647)

Atlas Antibodies

Catalog No.:
ATL-HPA068647-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RAB20, member RAS oncogene family
Gene Name: RAB20
Alternative Gene Name: FLJ20429
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031504: 80%, ENSRNOG00000023991: 74%
Entrez Gene ID: 55647
Uniprot ID: Q9NX57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA
Gene Sequence KTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA
Gene ID - Mouse ENSMUSG00000031504
Gene ID - Rat ENSRNOG00000023991
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAB20 pAb (ATL-HPA068647)
Datasheet Anti RAB20 pAb (ATL-HPA068647) Datasheet (External Link)
Vendor Page Anti RAB20 pAb (ATL-HPA068647) at Atlas Antibodies

Documents & Links for Anti RAB20 pAb (ATL-HPA068647)
Datasheet Anti RAB20 pAb (ATL-HPA068647) Datasheet (External Link)
Vendor Page Anti RAB20 pAb (ATL-HPA068647)