Anti RAB20 pAb (ATL-HPA052111)

Atlas Antibodies

Catalog No.: ATL-HPA052111-25

Protein Description: RAB20, member RAS oncogene family
Gene Name: RAB20
Alternative Gene Name: FLJ20429
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031504: 96%, ENSRNOG00000023991: 98%
Entrez Gene ID: 55647
Uniprot ID: Q9NX57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYCR
• Gene Sequence: LLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYCR
• Gene ID - Mouse: ENSMUSG00000031504
• Gene ID - Rat: ENSRNOG00000023991
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.