Anti RAB19 pAb (ATL-HPA051077)
Atlas Antibodies
- SKU:
- ATL-HPA051077-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RAB19
Alternative Gene Name: RAB19B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029923: 95%, ENSRNOG00000009030: 97%
Entrez Gene ID: 401409
Uniprot ID: A4D1S5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LIGNKCDLWEKRHVLFEDACTLAEKYGLLAVLETSAKES |
Gene Sequence | LIGNKCDLWEKRHVLFEDACTLAEKYGLLAVLETSAKES |
Gene ID - Mouse | ENSMUSG00000029923 |
Gene ID - Rat | ENSRNOG00000009030 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RAB19 pAb (ATL-HPA051077) | |
Datasheet | Anti RAB19 pAb (ATL-HPA051077) Datasheet (External Link) |
Vendor Page | Anti RAB19 pAb (ATL-HPA051077) at Atlas Antibodies |
Documents & Links for Anti RAB19 pAb (ATL-HPA051077) | |
Datasheet | Anti RAB19 pAb (ATL-HPA051077) Datasheet (External Link) |
Vendor Page | Anti RAB19 pAb (ATL-HPA051077) |