Anti RAB19 pAb (ATL-HPA051077)

Atlas Antibodies

SKU:
ATL-HPA051077-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RAB19, member RAS oncogene family
Gene Name: RAB19
Alternative Gene Name: RAB19B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029923: 95%, ENSRNOG00000009030: 97%
Entrez Gene ID: 401409
Uniprot ID: A4D1S5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIGNKCDLWEKRHVLFEDACTLAEKYGLLAVLETSAKES
Gene Sequence LIGNKCDLWEKRHVLFEDACTLAEKYGLLAVLETSAKES
Gene ID - Mouse ENSMUSG00000029923
Gene ID - Rat ENSRNOG00000009030
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RAB19 pAb (ATL-HPA051077)
Datasheet Anti RAB19 pAb (ATL-HPA051077) Datasheet (External Link)
Vendor Page Anti RAB19 pAb (ATL-HPA051077) at Atlas Antibodies

Documents & Links for Anti RAB19 pAb (ATL-HPA051077)
Datasheet Anti RAB19 pAb (ATL-HPA051077) Datasheet (External Link)
Vendor Page Anti RAB19 pAb (ATL-HPA051077)