Anti R3HDM4 pAb (ATL-HPA048638)

Atlas Antibodies

Catalog No.:
ATL-HPA048638-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: R3H domain containing 4
Gene Name: R3HDM4
Alternative Gene Name: C19orf22, MGC16353
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035781: 90%, ENSRNOG00000011489: 89%
Entrez Gene ID: 91300
Uniprot ID: Q96D70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLLRFFSVSPQAVYTAMLDNSFERLLLHAVCQYMDLISASADLEGKRQMKVSNRHLDFLPPGLLLSAYLEQHS
Gene Sequence RLLRFFSVSPQAVYTAMLDNSFERLLLHAVCQYMDLISASADLEGKRQMKVSNRHLDFLPPGLLLSAYLEQHS
Gene ID - Mouse ENSMUSG00000035781
Gene ID - Rat ENSRNOG00000011489
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti R3HDM4 pAb (ATL-HPA048638)
Datasheet Anti R3HDM4 pAb (ATL-HPA048638) Datasheet (External Link)
Vendor Page Anti R3HDM4 pAb (ATL-HPA048638) at Atlas Antibodies

Documents & Links for Anti R3HDM4 pAb (ATL-HPA048638)
Datasheet Anti R3HDM4 pAb (ATL-HPA048638) Datasheet (External Link)
Vendor Page Anti R3HDM4 pAb (ATL-HPA048638)