Anti QRFPR pAb (ATL-HPA050236)

Atlas Antibodies

Catalog No.:
ATL-HPA050236-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: pyroglutamylated RFamide peptide receptor
Gene Name: QRFPR
Alternative Gene Name: GPR103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058400: 63%, ENSRNOG00000014414: 63%
Entrez Gene ID: 84109
Uniprot ID: Q96P65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CIVNKTFSPAQRHGNSGITMMRKKAKFSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSELAEN
Gene Sequence CIVNKTFSPAQRHGNSGITMMRKKAKFSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSELAEN
Gene ID - Mouse ENSMUSG00000058400
Gene ID - Rat ENSRNOG00000014414
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti QRFPR pAb (ATL-HPA050236)
Datasheet Anti QRFPR pAb (ATL-HPA050236) Datasheet (External Link)
Vendor Page Anti QRFPR pAb (ATL-HPA050236) at Atlas Antibodies

Documents & Links for Anti QRFPR pAb (ATL-HPA050236)
Datasheet Anti QRFPR pAb (ATL-HPA050236) Datasheet (External Link)
Vendor Page Anti QRFPR pAb (ATL-HPA050236)