Anti QPRT pAb (ATL-HPA076010 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA076010-100

• 
• 
• 

Protein Description: quinolinate phosphoribosyltransferase
Gene Name: QPRT
Alternative Gene Name: QPRTase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030674: 81%, ENSRNOG00000016980: 78%
Entrez Gene ID: 23475
Uniprot ID: Q15274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKI
• Gene Sequence: LLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKI
• Gene ID - Mouse: ENSMUSG00000030674
• Gene ID - Rat: ENSRNOG00000016980
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.