Anti PYROXD2 pAb (ATL-HPA067394)

Atlas Antibodies

SKU:
ATL-HPA067394-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: pyridine nucleotide-disulphide oxidoreductase domain 2
Gene Name: PYROXD2
Alternative Gene Name: C10orf33, FLJ23849
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060224: 92%, ENSRNOG00000015807: 95%
Entrez Gene ID: 84795
Uniprot ID: Q8N2H3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLTAPITKVLDQWFESEPLKATLATDAVIGAMTSPHTPGSGYVLLHHVMGGLEGMQGAWGYVQGGMGALSDAIASSATTHGASIFTE
Gene Sequence VLTAPITKVLDQWFESEPLKATLATDAVIGAMTSPHTPGSGYVLLHHVMGGLEGMQGAWGYVQGGMGALSDAIASSATTHGASIFTE
Gene ID - Mouse ENSMUSG00000060224
Gene ID - Rat ENSRNOG00000015807
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PYROXD2 pAb (ATL-HPA067394)
Datasheet Anti PYROXD2 pAb (ATL-HPA067394) Datasheet (External Link)
Vendor Page Anti PYROXD2 pAb (ATL-HPA067394) at Atlas Antibodies

Documents & Links for Anti PYROXD2 pAb (ATL-HPA067394)
Datasheet Anti PYROXD2 pAb (ATL-HPA067394) Datasheet (External Link)
Vendor Page Anti PYROXD2 pAb (ATL-HPA067394)