Anti PYHIN1 pAb (ATL-HPA055373 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA055373-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: pyrin and HIN domain family member 1
Gene Name: PYHIN1
Alternative Gene Name: IFIX, MGC23885
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 149628
Uniprot ID: Q6K0P9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSSFTKKDETHPGAQSSPANFRITSPTVAPPLSSDTSTNRHPAV
Gene Sequence SSSFTKKDETHPGAQSSPANFRITSPTVAPPLSSDTSTNRHPAV
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PYHIN1 pAb (ATL-HPA055373 w/enhanced validation)
Datasheet Anti PYHIN1 pAb (ATL-HPA055373 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PYHIN1 pAb (ATL-HPA055373 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PYHIN1 pAb (ATL-HPA055373 w/enhanced validation)
Datasheet Anti PYHIN1 pAb (ATL-HPA055373 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PYHIN1 pAb (ATL-HPA055373 w/enhanced validation)