Anti PYHIN1 pAb (ATL-HPA051224 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051224-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PYHIN1
Alternative Gene Name: IFIX, MGC23885
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054203: 33%, ENSRNOG00000019875: 30%
Entrez Gene ID: 149628
Uniprot ID: Q6K0P9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IESIPVKGIIPSKKTKQKEVYPATPACTPSNRLTAKGAEETLGPQKRKKPSEEETGTKRSKMSKEQTRPSCS |
| Gene Sequence | IESIPVKGIIPSKKTKQKEVYPATPACTPSNRLTAKGAEETLGPQKRKKPSEEETGTKRSKMSKEQTRPSCS |
| Gene ID - Mouse | ENSMUSG00000054203 |
| Gene ID - Rat | ENSRNOG00000019875 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PYHIN1 pAb (ATL-HPA051224 w/enhanced validation) | |
| Datasheet | Anti PYHIN1 pAb (ATL-HPA051224 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PYHIN1 pAb (ATL-HPA051224 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PYHIN1 pAb (ATL-HPA051224 w/enhanced validation) | |
| Datasheet | Anti PYHIN1 pAb (ATL-HPA051224 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PYHIN1 pAb (ATL-HPA051224 w/enhanced validation) |
| Citations for Anti PYHIN1 pAb (ATL-HPA051224 w/enhanced validation) – 1 Found |
| Ding, Jian-Ming; Lin, Wen-Rong; Fei, Zhao-Dong; Chen, Chuan-Ben. PYHIN1 correlates with CD8+ T cells infiltration and confers good patient survival in oral cancer. Journal Of Dental Sciences. 2022;17(1):551-559. PubMed |