Anti PYGO2 pAb (ATL-HPA074813)

Atlas Antibodies

Catalog No.:
ATL-HPA074813-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: pygopus family PHD finger 2
Gene Name: PYGO2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047824: 97%, ENSRNOG00000020663: 96%
Entrez Gene ID: 90780
Uniprot ID: Q9BRQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSTGRKQGKAGLQMKSPEKKRRKSNTQGPAYSHLTEFAPPPTPMVDHLVASNPFEDDFGAPKVGVAAPPF
Gene Sequence PSTGRKQGKAGLQMKSPEKKRRKSNTQGPAYSHLTEFAPPPTPMVDHLVASNPFEDDFGAPKVGVAAPPF
Gene ID - Mouse ENSMUSG00000047824
Gene ID - Rat ENSRNOG00000020663
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PYGO2 pAb (ATL-HPA074813)
Datasheet Anti PYGO2 pAb (ATL-HPA074813) Datasheet (External Link)
Vendor Page Anti PYGO2 pAb (ATL-HPA074813) at Atlas Antibodies

Documents & Links for Anti PYGO2 pAb (ATL-HPA074813)
Datasheet Anti PYGO2 pAb (ATL-HPA074813) Datasheet (External Link)
Vendor Page Anti PYGO2 pAb (ATL-HPA074813)