Anti PXMP4 pAb (ATL-HPA050077)

Atlas Antibodies

SKU: ATL-HPA050077-25

• 
• 

Protein Description: peroxisomal membrane protein 4, 24kDa
Gene Name: PXMP4
Alternative Gene Name: PMP24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000876: 86%, ENSRNOG00000016975: 88%
Entrez Gene ID: 11264
Uniprot ID: Q9Y6I8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FEYHRSTLQPSLQSSMTYLYEDSNVWHDISDFLVYNKSRPSN
• Gene Sequence: FEYHRSTLQPSLQSSMTYLYEDSNVWHDISDFLVYNKSRPSN
• Gene ID - Mouse: ENSMUSG00000000876
• Gene ID - Rat: ENSRNOG00000016975
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.