Anti PWWP2B pAb (ATL-HPA078118)

Atlas Antibodies

Catalog No.: ATL-HPA078118-25

Protein Description: PWWP domain containing 2B
Gene Name: PWWP2B
Alternative Gene Name: bA432J24.1, FLJ46823, PWWP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060260: 79%, ENSRNOG00000036649: 77%
Entrez Gene ID: 170394
Uniprot ID: Q6NUJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRVEQVVNGALVVTVSCGERSFAGILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQL
• Gene Sequence: VRVEQVVNGALVVTVSCGERSFAGILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQL
• Gene ID - Mouse: ENSMUSG00000060260
• Gene ID - Rat: ENSRNOG00000036649
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.