Anti PWWP2A pAb (ATL-HPA058233)

Atlas Antibodies

Catalog No.:
ATL-HPA058233-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: PWWP domain containing 2A
Gene Name: PWWP2A
Alternative Gene Name: KIAA1935
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044950: 93%, ENSRNOG00000003936: 92%
Entrez Gene ID: 114825
Uniprot ID: Q96N64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSTVSQLIPGSEVRVTLDHIIEDALVVSFRFGEKLFSGVLMDLSKRFGPHGIPVTVFPKREYKDKPEAMPL
Gene Sequence DSTVSQLIPGSEVRVTLDHIIEDALVVSFRFGEKLFSGVLMDLSKRFGPHGIPVTVFPKREYKDKPEAMPL
Gene ID - Mouse ENSMUSG00000044950
Gene ID - Rat ENSRNOG00000003936
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PWWP2A pAb (ATL-HPA058233)
Datasheet Anti PWWP2A pAb (ATL-HPA058233) Datasheet (External Link)
Vendor Page Anti PWWP2A pAb (ATL-HPA058233) at Atlas Antibodies

Documents & Links for Anti PWWP2A pAb (ATL-HPA058233)
Datasheet Anti PWWP2A pAb (ATL-HPA058233) Datasheet (External Link)
Vendor Page Anti PWWP2A pAb (ATL-HPA058233)