Anti PVR pAb (ATL-HPA064739)

Atlas Antibodies

Catalog No.: ATL-HPA064739-25

Protein Description: poliovirus receptor
Gene Name: PVR
Alternative Gene Name: CD155, HVED, Necl-5, NECL5, PVS, Tage4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062300: 54%, ENSRNOG00000018730: 53%
Entrez Gene ID: 5817
Uniprot ID: P15151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILV
• Gene Sequence: QGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILV
• Gene ID - Mouse: ENSMUSG00000062300
• Gene ID - Rat: ENSRNOG00000018730
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.