Anti PUS1 pAb (ATL-HPA057593)

Atlas Antibodies

Catalog No.:
ATL-HPA057593-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: pseudouridylate synthase 1
Gene Name: PUS1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029507: 96%, ENSRNOG00000037500: 95%
Entrez Gene ID: 80324
Uniprot ID: Q9Y606
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKVWLIDDILEKINSHLPSHIRILGLKRVTGGFNSKNRCDARTYCYLLPTFAFAHKDRDVQDETYRLSAETLQQVNRLLACYKGTHNFHNFTSQ
Gene Sequence LKVWLIDDILEKINSHLPSHIRILGLKRVTGGFNSKNRCDARTYCYLLPTFAFAHKDRDVQDETYRLSAETLQQVNRLLACYKGTHNFHNFTSQ
Gene ID - Mouse ENSMUSG00000029507
Gene ID - Rat ENSRNOG00000037500
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PUS1 pAb (ATL-HPA057593)
Datasheet Anti PUS1 pAb (ATL-HPA057593) Datasheet (External Link)
Vendor Page Anti PUS1 pAb (ATL-HPA057593) at Atlas Antibodies

Documents & Links for Anti PUS1 pAb (ATL-HPA057593)
Datasheet Anti PUS1 pAb (ATL-HPA057593) Datasheet (External Link)
Vendor Page Anti PUS1 pAb (ATL-HPA057593)