Anti PTX4 pAb (ATL-HPA073694)

Atlas Antibodies

Catalog No.:
ATL-HPA073694-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: pentraxin 4
Gene Name: PTX4
Alternative Gene Name: C16orf38
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044172: 79%, ENSRNOG00000060934: 77%
Entrez Gene ID: 390667
Uniprot ID: Q96A99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGFDSSEAFVGSMSGLAIWDRALVPGEVANLAIGKEFPTGAILTLANAALAGGFVQGANCTCLERC
Gene Sequence GGFDSSEAFVGSMSGLAIWDRALVPGEVANLAIGKEFPTGAILTLANAALAGGFVQGANCTCLERC
Gene ID - Mouse ENSMUSG00000044172
Gene ID - Rat ENSRNOG00000060934
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTX4 pAb (ATL-HPA073694)
Datasheet Anti PTX4 pAb (ATL-HPA073694) Datasheet (External Link)
Vendor Page Anti PTX4 pAb (ATL-HPA073694) at Atlas Antibodies

Documents & Links for Anti PTX4 pAb (ATL-HPA073694)
Datasheet Anti PTX4 pAb (ATL-HPA073694) Datasheet (External Link)
Vendor Page Anti PTX4 pAb (ATL-HPA073694)