Anti PTRH1 pAb (ATL-HPA021223)

Atlas Antibodies

Catalog No.: ATL-HPA021223-25

Protein Description: peptidyl-tRNA hydrolase 1 homolog (S. cerevisiae)
Gene Name: PTRH1
Alternative Gene Name: C9orf115, PTH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053746: 84%, ENSRNOG00000049034: 84%
Entrez Gene ID: 138428
Uniprot ID: Q86Y79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VYLVHDELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATD
• Gene Sequence: VYLVHDELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATD
• Gene ID - Mouse: ENSMUSG00000053746
• Gene ID - Rat: ENSRNOG00000049034
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.