Anti PTRH1 pAb (ATL-HPA021223)

Atlas Antibodies

Catalog No.:
ATL-HPA021223-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: peptidyl-tRNA hydrolase 1 homolog (S. cerevisiae)
Gene Name: PTRH1
Alternative Gene Name: C9orf115, PTH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053746: 84%, ENSRNOG00000049034: 84%
Entrez Gene ID: 138428
Uniprot ID: Q86Y79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VYLVHDELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATD
Gene Sequence VYLVHDELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATD
Gene ID - Mouse ENSMUSG00000053746
Gene ID - Rat ENSRNOG00000049034
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTRH1 pAb (ATL-HPA021223)
Datasheet Anti PTRH1 pAb (ATL-HPA021223) Datasheet (External Link)
Vendor Page Anti PTRH1 pAb (ATL-HPA021223) at Atlas Antibodies

Documents & Links for Anti PTRH1 pAb (ATL-HPA021223)
Datasheet Anti PTRH1 pAb (ATL-HPA021223) Datasheet (External Link)
Vendor Page Anti PTRH1 pAb (ATL-HPA021223)