Anti PTRF pAb (ATL-HPA049838 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA049838-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: polymerase I and transcript release factor
Gene Name: PTRF
Alternative Gene Name: cavin-1, CAVIN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004044: 89%, ENSRNOG00000019778: 89%
Entrez Gene ID: 284119
Uniprot ID: Q6NZI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPSSAGAQAAEEPSGAGSEELIKSDQVNGVLVLSLLDKIIGAVDQIQLTQAQLEERQAEMEGAVQSIQGELSKLGK
Gene Sequence EPSSAGAQAAEEPSGAGSEELIKSDQVNGVLVLSLLDKIIGAVDQIQLTQAQLEERQAEMEGAVQSIQGELSKLGK
Gene ID - Mouse ENSMUSG00000004044
Gene ID - Rat ENSRNOG00000019778
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTRF pAb (ATL-HPA049838 w/enhanced validation)
Datasheet Anti PTRF pAb (ATL-HPA049838 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PTRF pAb (ATL-HPA049838 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PTRF pAb (ATL-HPA049838 w/enhanced validation)
Datasheet Anti PTRF pAb (ATL-HPA049838 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PTRF pAb (ATL-HPA049838 w/enhanced validation)
Citations for Anti PTRF pAb (ATL-HPA049838 w/enhanced validation) – 2 Found
Grivas, Dimitrios; González-Rajal, Álvaro; Guerrero Rodríguez, Carlos; Garcia, Ricardo; de la Pompa, José Luis. Loss of Caveolin-1 and caveolae leads to increased cardiac cell stiffness and functional decline of the adult zebrafish heart. Scientific Reports. 2020;10(1):12816.  PubMed
Low, Jin-Yih; Brennen, W Nathaniel; Meeker, Alan K; Ikonen, Elina; Simons, Brian W; Laiho, Marikki. Stromal CAVIN1 Controls Prostate Cancer Microenvironment and Metastasis by Modulating Lipid Distribution and Inflammatory Signaling. Molecular Cancer Research : Mcr. 2020;18(9):1414-1426.  PubMed