Anti PTPRR pAb (ATL-HPA071067)

Atlas Antibodies

SKU: ATL-HPA071067-25

• 

Protein Description: protein tyrosine phosphatase, receptor type, R
Gene Name: PTPRR
Alternative Gene Name: EC-PTP, PCPTP1, PTP-SL, PTPBR7, PTPRQ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020151: 80%, ENSRNOG00000004483: 80%
Entrez Gene ID: 5801
Uniprot ID: Q15256
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFK
• Gene Sequence: ERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFK
• Gene ID - Mouse: ENSMUSG00000020151
• Gene ID - Rat: ENSRNOG00000004483
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.