Anti PTPRR pAb (ATL-HPA071067)

Atlas Antibodies

Catalog No.:
ATL-HPA071067-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: protein tyrosine phosphatase, receptor type, R
Gene Name: PTPRR
Alternative Gene Name: EC-PTP, PCPTP1, PTP-SL, PTPBR7, PTPRQ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020151: 80%, ENSRNOG00000004483: 80%
Entrez Gene ID: 5801
Uniprot ID: Q15256
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFK
Gene Sequence ERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFK
Gene ID - Mouse ENSMUSG00000020151
Gene ID - Rat ENSRNOG00000004483
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTPRR pAb (ATL-HPA071067)
Datasheet Anti PTPRR pAb (ATL-HPA071067) Datasheet (External Link)
Vendor Page Anti PTPRR pAb (ATL-HPA071067) at Atlas Antibodies

Documents & Links for Anti PTPRR pAb (ATL-HPA071067)
Datasheet Anti PTPRR pAb (ATL-HPA071067) Datasheet (External Link)
Vendor Page Anti PTPRR pAb (ATL-HPA071067)