Anti PTPRN2 pAb (ATL-HPA026656)

Atlas Antibodies

Catalog No.: ATL-HPA026656-25

Protein Description: protein tyrosine phosphatase, receptor type, N polypeptide 2
Gene Name: PTPRN2
Alternative Gene Name: IA-2beta, ICAAR, KIAA0387, phogrin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056553: 54%, ENSRNOG00000005003: 59%
Entrez Gene ID: 5799
Uniprot ID: Q92932
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RFSESILTYVAHTSALTYPPGSRTQLREDLLPRTLGQLQPDELSPKVDSGVDRHHLMAALSAYAAQRPPAPPGEGSLEPQYLLRAPSRMPRPLLAPAAPQKWPSPLGDSEDPSST
• Gene Sequence: RFSESILTYVAHTSALTYPPGSRTQLREDLLPRTLGQLQPDELSPKVDSGVDRHHLMAALSAYAAQRPPAPPGEGSLEPQYLLRAPSRMPRPLLAPAAPQKWPSPLGDSEDPSST
• Gene ID - Mouse: ENSMUSG00000056553
• Gene ID - Rat: ENSRNOG00000005003
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PTPRN2 pAb (ATL-HPA026656) – 1 Found

Sorokin, Alexey V; Nair, Binoj C; Wei, Yongkun; Aziz, Kathryn E; Evdokimova, Valentina; Hung, Mien-Chie; Chen, Junjie. Aberrant Expression of proPTPRN2 in Cancer Cells Confers Resistance to Apoptosis. Cancer Research. 2015;75(9):1846-58.