Anti PTPRN2 pAb (ATL-HPA006900)

Atlas Antibodies

Catalog No.: ATL-HPA006900-25

Protein Description: protein tyrosine phosphatase, receptor type, N polypeptide 2
Gene Name: PTPRN2
Alternative Gene Name: IA-2beta, ICAAR, KIAA0387, phogrin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056553: 50%, ENSRNOG00000005003: 54%
Entrez Gene ID: 5799
Uniprot ID: Q92932
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDDDDRLYQEVHRLSATLGGLLQDHGSRLLPGALPFARPLDMERKKSEHPESSLSSEEETAGVENVKSQTYSKDLLGQQPHSEPGAAAFGELQNQMPGPSKEEQSLPAGAQ
• Gene Sequence: QDDDDRLYQEVHRLSATLGGLLQDHGSRLLPGALPFARPLDMERKKSEHPESSLSSEEETAGVENVKSQTYSKDLLGQQPHSEPGAAAFGELQNQMPGPSKEEQSLPAGAQ
• Gene ID - Mouse: ENSMUSG00000056553
• Gene ID - Rat: ENSRNOG00000005003
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PTPRN2 pAb (ATL-HPA006900) – 2 Found

Sorokin, Alexey V; Nair, Binoj C; Wei, Yongkun; Aziz, Kathryn E; Evdokimova, Valentina; Hung, Mien-Chie; Chen, Junjie. Aberrant Expression of proPTPRN2 in Cancer Cells Confers Resistance to Apoptosis. Cancer Research. 2015;75(9):1846-58. 

Sengelaub, Caitlin A; Navrazhina, Kristina; Ross, Jason B; Halberg, Nils; Tavazoie, Sohail F. PTPRN2 and PLCβ1 promote metastatic breast cancer cell migration through PI(4,5)P2-dependent actin remodeling. The Embo Journal. 2016;35(1):62-76.