Anti PTPRG pAb (ATL-HPA064237)

Atlas Antibodies

SKU: ATL-HPA064237-25

• 

Protein Description: protein tyrosine phosphatase, receptor type, G
Gene Name: PTPRG
Alternative Gene Name: PTPG, RPTPG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021745: 90%, ENSRNOG00000009419: 70%
Entrez Gene ID: 5793
Uniprot ID: P23470
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALHENRHGSAVQIRRRKASGDPYWAYSGAYGPEHWVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLKDDYFVS
• Gene Sequence: ALHENRHGSAVQIRRRKASGDPYWAYSGAYGPEHWVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLKDDYFVS
• Gene ID - Mouse: ENSMUSG00000021745
• Gene ID - Rat: ENSRNOG00000009419
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.