Anti PTPRD pAb (ATL-HPA054829)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054829-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PTPRD
Alternative Gene Name: HPTP, PTPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028399: 99%, ENSRNOG00000005711: 99%
Entrez Gene ID: 5789
Uniprot ID: P23468
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human, Mouse |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEE |
Gene Sequence | GREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEE |
Gene ID - Mouse | ENSMUSG00000028399 |
Gene ID - Rat | ENSRNOG00000005711 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PTPRD pAb (ATL-HPA054829) | |
Datasheet | Anti PTPRD pAb (ATL-HPA054829) Datasheet (External Link) |
Vendor Page | Anti PTPRD pAb (ATL-HPA054829) at Atlas Antibodies |
Documents & Links for Anti PTPRD pAb (ATL-HPA054829) | |
Datasheet | Anti PTPRD pAb (ATL-HPA054829) Datasheet (External Link) |
Vendor Page | Anti PTPRD pAb (ATL-HPA054829) |