Anti PTPRA pAb (ATL-HPA069480)

Atlas Antibodies

Catalog No.:
ATL-HPA069480-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: protein tyrosine phosphatase, receptor type, A
Gene Name: PTPRA
Alternative Gene Name: HLPR, HPTPA, LRP, PTPA, PTPRL2, RPTPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027303: 80%, ENSRNOG00000021223: 80%
Entrez Gene ID: 5786
Uniprot ID: P18433
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPP
Gene Sequence EPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPP
Gene ID - Mouse ENSMUSG00000027303
Gene ID - Rat ENSRNOG00000021223
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTPRA pAb (ATL-HPA069480)
Datasheet Anti PTPRA pAb (ATL-HPA069480) Datasheet (External Link)
Vendor Page Anti PTPRA pAb (ATL-HPA069480) at Atlas Antibodies

Documents & Links for Anti PTPRA pAb (ATL-HPA069480)
Datasheet Anti PTPRA pAb (ATL-HPA069480) Datasheet (External Link)
Vendor Page Anti PTPRA pAb (ATL-HPA069480)