Anti PTPN5 pAb (ATL-HPA072091)

Atlas Antibodies

SKU: ATL-HPA072091-25

• 

Protein Description: protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)
Gene Name: PTPN5
Alternative Gene Name: PTPSTEP, STEP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030854: 91%, ENSRNOG00000013981: 92%
Entrez Gene ID: 84867
Uniprot ID: P54829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHY
• Gene Sequence: EHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHY
• Gene ID - Mouse: ENSMUSG00000030854
• Gene ID - Rat: ENSRNOG00000013981
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.