Anti PTPN3 pAb (ATL-HPA046728)

Atlas Antibodies

Catalog No.:
ATL-HPA046728-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protein tyrosine phosphatase, non-receptor type 3
Gene Name: PTPN3
Alternative Gene Name: PTPH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038764: 85%, ENSRNOG00000011425: 85%
Entrez Gene ID: 5774
Uniprot ID: P26045
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FIKASRESHSRELALVIRRRAVRSFADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFE
Gene Sequence FIKASRESHSRELALVIRRRAVRSFADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFE
Gene ID - Mouse ENSMUSG00000038764
Gene ID - Rat ENSRNOG00000011425
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTPN3 pAb (ATL-HPA046728)
Datasheet Anti PTPN3 pAb (ATL-HPA046728) Datasheet (External Link)
Vendor Page Anti PTPN3 pAb (ATL-HPA046728) at Atlas Antibodies

Documents & Links for Anti PTPN3 pAb (ATL-HPA046728)
Datasheet Anti PTPN3 pAb (ATL-HPA046728) Datasheet (External Link)
Vendor Page Anti PTPN3 pAb (ATL-HPA046728)