Anti PTPN23 pAb (ATL-HPA016845)

Atlas Antibodies

Catalog No.: ATL-HPA016845-25

Protein Description: protein tyrosine phosphatase, non-receptor type 23
Gene Name: PTPN23
Alternative Gene Name: DKFZP564F0923, HD-PTP, KIAA1471
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036057: 90%, ENSRNOG00000020862: 89%
Entrez Gene ID: 25930
Uniprot ID: Q9H3S7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLDQFMDSMQLDPETVDNLDAYSHIPPQLMEKCAALSVRPDTVRNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELLEQKFQEAVGQAGAISITSKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGN
• Gene Sequence: VLDQFMDSMQLDPETVDNLDAYSHIPPQLMEKCAALSVRPDTVRNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELLEQKFQEAVGQAGAISITSKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGN
• Gene ID - Mouse: ENSMUSG00000036057
• Gene ID - Rat: ENSRNOG00000020862
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.