Anti PTPN23 pAb (ATL-HPA016845)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016845-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PTPN23
Alternative Gene Name: DKFZP564F0923, HD-PTP, KIAA1471
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036057: 90%, ENSRNOG00000020862: 89%
Entrez Gene ID: 25930
Uniprot ID: Q9H3S7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VLDQFMDSMQLDPETVDNLDAYSHIPPQLMEKCAALSVRPDTVRNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELLEQKFQEAVGQAGAISITSKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGN |
| Gene Sequence | VLDQFMDSMQLDPETVDNLDAYSHIPPQLMEKCAALSVRPDTVRNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELLEQKFQEAVGQAGAISITSKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGN |
| Gene ID - Mouse | ENSMUSG00000036057 |
| Gene ID - Rat | ENSRNOG00000020862 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PTPN23 pAb (ATL-HPA016845) | |
| Datasheet | Anti PTPN23 pAb (ATL-HPA016845) Datasheet (External Link) |
| Vendor Page | Anti PTPN23 pAb (ATL-HPA016845) at Atlas Antibodies |
| Documents & Links for Anti PTPN23 pAb (ATL-HPA016845) | |
| Datasheet | Anti PTPN23 pAb (ATL-HPA016845) Datasheet (External Link) |
| Vendor Page | Anti PTPN23 pAb (ATL-HPA016845) |