Anti PTPN22 pAb (ATL-HPA004912)

Atlas Antibodies

Catalog No.:
ATL-HPA004912-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
Gene Name: PTPN22
Alternative Gene Name: Lyp, Lyp1, Lyp2, PTPN8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027843: 57%, ENSRNOG00000019614: 59%
Entrez Gene ID: 26191
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKWQTKAFPIVGEPLQKHQSLDLGSLLFEGCSNSKPVNAAGRYFNSKVPITRTKS
Gene Sequence SEISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKWQTKAFPIVGEPLQKHQSLDLGSLLFEGCSNSKPVNAAGRYFNSKVPITRTKS
Gene ID - Mouse ENSMUSG00000027843
Gene ID - Rat ENSRNOG00000019614
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTPN22 pAb (ATL-HPA004912)
Datasheet Anti PTPN22 pAb (ATL-HPA004912) Datasheet (External Link)
Vendor Page Anti PTPN22 pAb (ATL-HPA004912) at Atlas Antibodies

Documents & Links for Anti PTPN22 pAb (ATL-HPA004912)
Datasheet Anti PTPN22 pAb (ATL-HPA004912) Datasheet (External Link)
Vendor Page Anti PTPN22 pAb (ATL-HPA004912)