Anti PTPN20 pAb (ATL-HPA048310)

Atlas Antibodies

Catalog No.:
ATL-HPA048310-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: protein tyrosine phosphatase, non-receptor type 20
Gene Name: PTPN20
Alternative Gene Name: bA142I17.1, bA42B19.1, CT126, DKFZP566K0524, PTPN20A, PTPN20B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021940: 65%, ENSRNOG00000020203: 55%
Entrez Gene ID: 26095
Uniprot ID: Q4JDL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MALELKNLPGEFNSGNQPSNREKNRYRDILP
Gene Sequence MALELKNLPGEFNSGNQPSNREKNRYRDILP
Gene ID - Mouse ENSMUSG00000021940
Gene ID - Rat ENSRNOG00000020203
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTPN20 pAb (ATL-HPA048310)
Datasheet Anti PTPN20 pAb (ATL-HPA048310) Datasheet (External Link)
Vendor Page Anti PTPN20 pAb (ATL-HPA048310) at Atlas Antibodies

Documents & Links for Anti PTPN20 pAb (ATL-HPA048310)
Datasheet Anti PTPN20 pAb (ATL-HPA048310) Datasheet (External Link)
Vendor Page Anti PTPN20 pAb (ATL-HPA048310)