Anti PTPN20 pAb (ATL-HPA048310)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048310-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PTPN20
Alternative Gene Name: bA142I17.1, bA42B19.1, CT126, DKFZP566K0524, PTPN20A, PTPN20B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021940: 65%, ENSRNOG00000020203: 55%
Entrez Gene ID: 26095
Uniprot ID: Q4JDL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MALELKNLPGEFNSGNQPSNREKNRYRDILP |
| Gene Sequence | MALELKNLPGEFNSGNQPSNREKNRYRDILP |
| Gene ID - Mouse | ENSMUSG00000021940 |
| Gene ID - Rat | ENSRNOG00000020203 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PTPN20 pAb (ATL-HPA048310) | |
| Datasheet | Anti PTPN20 pAb (ATL-HPA048310) Datasheet (External Link) |
| Vendor Page | Anti PTPN20 pAb (ATL-HPA048310) at Atlas Antibodies |
| Documents & Links for Anti PTPN20 pAb (ATL-HPA048310) | |
| Datasheet | Anti PTPN20 pAb (ATL-HPA048310) Datasheet (External Link) |
| Vendor Page | Anti PTPN20 pAb (ATL-HPA048310) |