Anti PTPN20 pAb (ATL-HPA048310)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048310-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PTPN20
Alternative Gene Name: bA142I17.1, bA42B19.1, CT126, DKFZP566K0524, PTPN20A, PTPN20B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021940: 65%, ENSRNOG00000020203: 55%
Entrez Gene ID: 26095
Uniprot ID: Q4JDL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MALELKNLPGEFNSGNQPSNREKNRYRDILP |
Gene Sequence | MALELKNLPGEFNSGNQPSNREKNRYRDILP |
Gene ID - Mouse | ENSMUSG00000021940 |
Gene ID - Rat | ENSRNOG00000020203 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PTPN20 pAb (ATL-HPA048310) | |
Datasheet | Anti PTPN20 pAb (ATL-HPA048310) Datasheet (External Link) |
Vendor Page | Anti PTPN20 pAb (ATL-HPA048310) at Atlas Antibodies |
Documents & Links for Anti PTPN20 pAb (ATL-HPA048310) | |
Datasheet | Anti PTPN20 pAb (ATL-HPA048310) Datasheet (External Link) |
Vendor Page | Anti PTPN20 pAb (ATL-HPA048310) |