Anti PTPN2 pAb (ATL-HPA046176 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA046176-25

• 
• 
• 

Protein Description: protein tyrosine phosphatase, non-receptor type 2
Gene Name: PTPN2
Alternative Gene Name: PTPT, TC-PTP, TCELLPTP, TCPTP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024539: 78%, ENSRNOG00000017453: 66%
Entrez Gene ID: 5771
Uniprot ID: P17706
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAFDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKATTAQKVQQMKQRLNENERKRKRWLYWQP
• Gene Sequence: PAFDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKATTAQKVQQMKQRLNENERKRKRWLYWQP
• Gene ID - Mouse: ENSMUSG00000024539
• Gene ID - Rat: ENSRNOG00000017453
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.